PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_07958A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family MYB_related
Protein Properties Length: 469aa    MW: 50833.4 Da    PI: 4.4745
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_07958AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding39.21.7e-1283124346
                                SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
            Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                                +WT eE +ll+++ + +Gg+ W+ Ia+++  ++t  qc +++++
  Oropetium_20150105_07958A  83 SWTDEETLLLLEGLEIFGGK-WAEIAEHVA-TKTKAQCMLHFLQ 124
                                7*******************.*********.**********987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466896.58E-1379133IPR009057Homeodomain-like
PROSITE profilePS5129321.68879130IPR017884SANT domain
SMARTSM007178.5E-1380128IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.5E-982123IPR009057Homeodomain-like
PfamPF002499.9E-1283125IPR001005SANT/Myb domain
CDDcd001670.00132101125No hitNo description
PfamPF164951.3E-21355433IPR032451SMARCC, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 469 aa     Download sequence    Send to blast
MLHSGPLTRA ARQSPHKLAS TPPESGPASA SASAAGERTG GGQADFDLCC DCYNEGKFDA  60
GMSKTDFILM DSAEVSGGAS GTSWTDEETL LLLEGLEIFG GKWAEIAEHV ATKTKAQCML  120
HFLQMQIEDR FHDGEDIHQN IPGGSTDQAL TEKDTAQKPD KMKVDDKAEE KDNADEKPAE  180
TTEGNCEEEK KEDASAEANK DTQNSGGKDS VASPNTEEPK QSSDAHPSAD VDTSSKNLTN  240
VAIDILKSAF EAIGQSPDHE GSFADIGNPV MALDKPSTEL EASDETPLKG KDELDQHEDA  300
ASTPAATVQE QKQSQTFENG KIEEPNNTES LVANEGSIVT ASKNDSITKL KRAAATAISA  360
AGVKAKFLAE HEEYQIRRLT ALMIEKLFQK IEVKMSLFAE IEQVVLRTRE YTEKTRKKLL  420
MERNAIIAAR MGALXXXXXX XXXXXXXXXX XXXXXXXXXX XXMPRPSS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004981947.11e-109PREDICTED: SWI/SNF complex subunit SWI3D isoform X2
TrEMBLK4A5I21e-108K4A5I2_SETIT; Uncharacterized protein
STRINGSi034135m1e-108(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP45421214